CAMPSQ990
Title : Antimicrobial peptide des Gly1 NK-lysin
GenInfo Identifier : 2498644
Source : Sus scrofa [pig]
Taxonomy : Animalia, Mammals
UniProt: Q29075
PDB: 1NKL
Structure Database : CAMPST533
PubMed : 7737114
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Escherichia coli D21 ( MIC = 8 microM), Bacillus megaterium ( MIC = 0.8 microM), moderate PIG Escherichia coli Bd2221/75 ( MIC = 39 microM), Acinetobacter calcoaceticus ND, Streptococcus pyogeneis (MIC = 34 microM), Candida albicans ( MIC = 31 microM)
Validated : Experimentally validated
Comment : Inactive against Pseudomonas aeruginosa (ND), Staphylococcus aureus ( LC >190 microM) , Salmonella LT-2 ( LC > 170 microM)
Pfam : PF05184 : SapB_1 ( Saposin-like type B, region 1 )
PF03489 : SapB_2 ( Saposin-like type B, region 2 )
InterPro : IPR007856 : SapB_1.
IPR008138 : SapB_2.
IPR011001 : Saposin-like.
IPR008139 : SaposinB.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IBA
GO:0042742 Biological process Defense response to bacterium IBA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IBA
GO:0006629 Biological process Lipid metabolic process IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IBA
GO:0042742 Biological process Defense response to bacterium IBA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of another organism IBA
GO:0006629 Biological process Lipid metabolic process IEA
Length : 77
Sequence:
LICESCRKIIQKLEDMVGPQPNEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKDIL
TGKKPQAICVDIKICKE

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India