CAMPSQ979
Title : Cathelin-related antimicrobial peptide
GenInfo Identifier : 1706115
Source : Mus musculus [Mouse]
Taxonomy : Animalia, Mammals
UniProt: P51437
PubMed : 9148921
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Escherichia coli ATCC 25922 (MIC = 1microM), Escherichia coli ML35 (MIC = 2microM), Escherichia coli D21 (MIC = 8microM), Pseudomonas aeruginosa ATCC 27853 (MIC = 4microM), Serratia marcescens ATCC 8100 (MIC = 4microM), Staphylococcus aureus ATCC 25923 (MIC = 32microM), Staphylococcus aureus Cowan I (MIC = 32microM), Staphylococcus aureus (MRSA) (MIC > 64microM), Staphylococcus aureus MRSA (MIC = 64 microM), Staphylococcus epidermidis ATCC 12228 (MIC = 16 microM) , Streptococcus faecalis ATCC 29212 (MIC = 16 microM) , Bacillus megaterium Bm11 (MIC = 4 microM) , Candida albicans (MIC > 64 microM) , Cryptococcus neoformans (MIC = 16 microM)
Validated : Experimentally validated
Pfam : PF12153 : CAP18_C ( LPS binding domain of CAP18 (C terminal) )
InterPro : IPR001894 : Cathelicidin.
IPR018216 : Cathelicidin_CS.
IPR022746 : Cathlecidin_C.
AMP Family : Cathelicidin
Signature :
ID Type Pattern / HMM
CathelicidinH_140 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0042995 Cellular component Cell projection ISO
GO:0005737 Cellular component Cytoplasm ISO
GO:0005615 Cellular component Extracellular space ISO
GO:0042581 Cellular component Specific granule IDA
GO:0001530 Molecular function Lipopolysaccharide binding IBA
GO:0019731 Biological process Antibacterial humoral response ISO
GO:0019732 Biological process Antifungal humoral response ISO
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IMP
GO:0071347 Biological process Cellular response to interleukin-1 IEA
GO:0071354 Biological process Cellular response to interleukin-6 IEA
GO:0071222 Biological process Cellular response to lipopolysaccharide IEA
GO:0071224 Biological process Cellular response to peptidoglycan IEA
GO:0071356 Biological process Cellular response to tumor necrosis factor IEA
GO:0002544 Biological process Chronic inflammatory response ISO
GO:0051838 Biological process Cytolysis by host of symbiont cells ISO
GO:0042742 Biological process Defense response to bacterium IMP
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IMP
GO:0045087 Biological process Innate immune response IMP
GO:0002227 Biological process Innate immune response in mucosa ISO
GO:0051873 Biological process Killing by host of symbiont cells IMP
GO:0035821 Biological process Modulation of process of other organism ISO
GO:0042119 Biological process Neutrophil activation ISS
GO:0045766 Biological process Positive regulation of angiogenesis ISO
GO:0008284 Biological process Positive regulation of cell population proliferation ISO
GO:0032757 Biological process Positive regulation of interleukin-8 production ISO
GO:0001934 Biological process Positive regulation of protein phosphorylation ISO
GO:0001878 Biological process Response to yeast ISO
GO:0042995 Cellular component Cell projection ISO
GO:0005737 Cellular component Cytoplasm ISO
GO:0005615 Cellular component Extracellular space ISO
GO:0042581 Cellular component Specific granule IDA
GO:0001530 Molecular function Lipopolysaccharide binding IBA
GO:0019731 Biological process Antibacterial humoral response ISO
GO:0019732 Biological process Antifungal humoral response ISO
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IMP
GO:0071347 Biological process Cellular response to interleukin-1 IEA
GO:0071354 Biological process Cellular response to interleukin-6 IEA
GO:0071222 Biological process Cellular response to lipopolysaccharide IEA
GO:0071224 Biological process Cellular response to peptidoglycan IEA
GO:0071356 Biological process Cellular response to tumor necrosis factor IEA
GO:0002544 Biological process Chronic inflammatory response ISO
GO:0051838 Biological process Cytolysis by host of symbiont cells ISO
GO:0042742 Biological process Defense response to bacterium IMP
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IMP
GO:0045087 Biological process Innate immune response IMP
GO:0002227 Biological process Innate immune response in mucosa ISO
GO:0051873 Biological process Killing by host of symbiont cells IMP
GO:0035821 Biological process Modulation of process of another organism ISO
GO:0042119 Biological process Neutrophil activation ISS
GO:0045766 Biological process Positive regulation of angiogenesis ISO
GO:0008284 Biological process Positive regulation of cell population proliferation ISO
GO:0032757 Biological process Positive regulation of interleukin-8 production ISO
GO:0001934 Biological process Positive regulation of protein phosphorylation ISO
GO:0001878 Biological process Response to yeast ISO
Length : 38
Sequence:
ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India