CAMPSQ975
Title : Ostricacin-4
GenInfo Identifier : 145566914
Source : Struthio camelus [Ostrich]
Taxonomy : Animalia, Aves
UniProt: P85116
PubMed : 16459058
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
S.aureus 1056 MRSA (MIC = 11.48 microg/ml) , E.coli O157:H7 (MIC = 12.03 microg/ml)
Validated : Experimentally validated
Comment : Inactive against C.albicans 3153A
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 42
Sequence:
LPVNEAQCRQVGGYCGLRICNFPSRFLGLCTRNHPCCSRVWV

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India