CAMPSQ966
Title : Recombinant Crassostrea Gigas Defensin
GenInfo Identifier : 159163764
Source : Crassostrea gigas [Pacific oyster]
Taxonomy : Animalia, Molluscs (Bivalvia)
UniProt: Q4GWV4
PDB: 2B68
Structure Database : CAMPST109
PubMed : 16246846
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
M. lysodeikticus ( MIC = 0.005-0.01 microM ), S. aureus ( MIC = 1.25-2.5 microM), B. stationis ( MIC =0.1-0.2 microM ), M. maritypicum ( MIC = 0.5-1 microM ), B. megaterium ( MIC = >20 microM ) , E. coli 363 ( MIC = 35-20 microM ), V. alginolyticus ( MIC >20 microM ), S. typhimurium ( MIC >20 microM ), F. oxysporum ( MIC = 9-4.5 microM ), B. cinerea ( MIC >20 microM ) , P. crustosum ( MIC >20 microM )
Validated : Experimentally validated
Pfam : PF01097 : Defensin_2 ( Arthropod defensin )
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0016020 Cellular component Membrane IEA
GO:0008289 Molecular function Lipid binding IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 43
Sequence:
GFGCPGNQLKCNNHCKSISCRAGYCDAATLWLRCTCTDCNGKK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India