CAMPSQ931
Title : Tachystatin-C
GenInfo Identifier : 150387846
Source : Tachypleus tridentatus [Japanese horseshoe crab]
Taxonomy : Animalia
UniProt: P0C200
PubMed : 10473569
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
Escherichia coli ( IC50 = 1.2 microg/ml ), Staphylococcus aureus ( IC50 = 0.8 microg/ml ), Candida albicans ( IC50 = 0.9 microg/ml ), Pseudomonas pastoris ( IC50 = 0.3 microg/ml )
Validated : Experimentally validated
AMP Family : Tachystatin
Signature :
ID Type Pattern / HMM
TachystatinH_7 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0044179 Biological process Hemolysis in other organism IEA
Length : 41
Sequence:
DYDWSLRGPPKCATYGQKCRTWSPPNCCWNLRCKAFRCRPR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India