CAMPSQ923
Title : Scarabaecin
GenInfo Identifier : 74813990
Source : Oryctes rhinoceros [Coconut rhinoceros beetle]
Taxonomy : Animalia, Insects
UniProt: Q86SC0
PDB: 1IYC
Structure Database : CAMPST30
PubMed : 12859949
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve
Target :
Pyricularia oryzae, Rhizoctonia solani, Botrytis cinerea ,Beauveria bassiana (weak activity), Staphylococcus aureus (weak activity)
Validated : Experimentally validated
Comment : Inactive against phytopathogenic bacteria
InterPro : IPR002557 : Chitin-bd_dom.
AMP Family : Abaecin
Signature :
ID Type Pattern / HMM
AbaecinH_7 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0008061 Molecular function Chitin binding IDA
GO:0050832 Biological process Defense response to fungus IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 36
Sequence:
ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India