CAMPSQ905
Title : Rhinocerosin
GenInfo Identifier : 6093969
Source : Oryctes rhinoceros [Coconut rhinoceros beetle]
Taxonomy : Animalia, Insects
UniProt: O76145
PubMed : 9738915
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
E. coli ( MIC = 1microg/ml), S. aureus ( MIC = 1microg/ml), S. pyogenes ( MIC = 1microg/ml)
Validated : Experimentally validated
Comment : Inactive against P. aeruginosa
Pfam : PF06286 : Coleoptericin ( Coleoptericin )
InterPro : IPR009382 : Coleoptericin.
AMP Family : Coleoptericin
Signature :
ID Type Pattern / HMM
ColeoptericinH_6 HMM
ColeoptericinP_6 Pattern N-T-x-[AGT]-[DQST]-I-[DEN]-[AIV]-x(3)-[GT]-x-[DNR]-x-[DE]-[FV]-x-[AG]-[GNT]-W-[DGNST]-K-V-[IV]-[DR]-G-P-[GN]-[KR]-[AS]-K-P-[NT]-[FWY]-x-[IV]-x-G-[ST]-[HWY]-R
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 72
Sequence:
SLQPGAPNFPMPGSQLPTSITSNIEKQGPNTAATINAQHKTDRYDVGATWSKVIRGPGRS
KPNWSIGGTYRW

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India