CAMPSQ898
Title : Neutrophil cationic antibacterial polypeptide of 11 kDa
GenInfo Identifier : 81867362
Source : Cavia porcellus [Guinea pig]
Taxonomy : Animalia, Mammals
UniProt: Q91X12
PubMed : 8644997
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
E. coli ( ED50 = 30-35 nM ) , S.aureus ( ED50 = 90-120 nM )
Validated : Experimentally validated
InterPro : IPR001894 : Cathelicidin.
IPR018216 : Cathelicidin_CS.
AMP Family : Cathelicidin
Signature :
ID Type Pattern / HMM
CathelicidinH_140 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0006952 Biological process Defense response IEA
GO:0006955 Biological process Immune response IEA
GO:0051707 Biological process Response to other organism IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 43
Sequence:
GLRKKFRKTRKRIQKLGRKIGKTGRKVWKAWREYGQIPYPCRI

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India