CAMPSQ835
Title : Microcin L
GenInfo Identifier : 30026596
Source : Escherichia coli
Taxonomy : Bacteria
NCBI Taxonomy : 562
UniProt: Q841V4
PubMed : 14742202
Length : 90
Activity : Antibacterial
Gram Nature : Gram-ve
Target : Escherichia coli , Klebsiella oxytoca CIP666 , Salmonella enterica serovar Agona , Salmonella enterica serovar Braenderup , Salmonella enterica serovar Brandenburg , Salmonella enterica serovar Bredeney , Salmonella enterica serovar Derby , Salmonella ent
Validated : Experimentally Validated
Comment : Inactive against Citrobacter freundii , Hafnia alvei CIP5731T , Hafnia alvei Klebsiella pneumoniae , Serratia marcescens CIP6755 , Serratia marcescens Proteus mirabilis , Proteus morganii , Proteus vulgaris , Pseudomonas stutzeri , Bacillus cereus , Baci
InterPro : IPR020280 : Colicin-V.
AMP Family : Bacteriocin
Sequence:
GDVNWVDVGKTVATNGAGVIGGAFGAGLCGPVCAGAFAVGSSAAVAALYDAAGNSNSAKQ
KPEGLPPEAWNYAEGRMCNWSPNNLSDVCL