CAMPSQ817
Title : Enterocin B
Source : Enterococcus faecium T136
Taxonomy : Monera
PubMed : Reference: Komori, T., Yamada, S., Imaseki, H. (1997). Plant Physiol. 115, 314.
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
Listeriae, Staphylococci and most Lactic acid bacteria
Validated : Experimentally validated
AMP Family : Bacteriocin
Length : 53
Sequence:
ENDHRMPNNLNRPNNLSKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYSKCN

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India