CAMPSQ804
Title : Sakacin G immunity protein
GenInfo Identifier : 175950732
Source : Lactobacillus sakei 2512
Taxonomy : Bacteria
NCBI Taxonomy : 1599
UniProt: B2LS02
PubMed : 11555873
Length : 37
Activity : Antibacterial
Gram Nature : Gram+ve
Target : Lactobacillus sake 2515 , Pediococcus cerevisiae IP 5492 , Enterococcus faecalis IP 5430 , Enterococcus faecalis ENSAIA 636 , Enterococcus durans ENSAIA 630 , Listeria inocua 8811 , Listeria monocytogenes EGDe , Listeria monocytogenes LO28 , Listeria ivan
Validated : Experimentally Validated
Comment : Inactive against Lactococcus lactis ATCC 11454 , Leuconostoc paramesenteroides DSM 20288 , Leuconostoc mesenteroides DSM 20484 , Leuconostoc mesenteroides DSM 20240 , Lactobacillus delbrueckii DSM 20081 , Lactobacillus plantarum DSM 20174 , Lactobacillus
Pfam : PF08951 : ( Enterocin A Immunity )
InterPro : IPR015046 : EntA_Immun.
AMP Family : Bacteriocin
Sequence:
KYYGNGVSCNSHGCSVNWGQAWTCGVNHLANGGHGVC