CAMPSQ797
Title : Enterocin E-760
GenInfo Identifier : 182628290
Source : Enterococcus sp.
Taxonomy : Bacteria
NCBI Taxonomy : 35783
UniProt: P85147
PubMed : 7628617
Length : 62
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Target : S. enterica serovar Enteritidis 1 ( MIC = 0.2 microg/ml) , S. enterica serovar Enteritidis 4 ( MIC = 0.4 microg/ml) , S. enterica serovar Enteritidis 204 ( MIC = 0.2 microg/ml) , S. enterica serovar Enteritidis 237 ( MIC = 0.2 microg/ml) , S. enterica ser
Validated : Experimentally Validated
AMP Family : Bacteriocin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0019835 Biological Process Cytolysis IEA
GO:0042742 Biological Process Defense response to bacterium IEA
Sequence:
NRWYCNSAAGGVGGAAVCGLAGYVGEAKENIAGEVRKGWGMAGGFTHNKACKSFPGSGWA
SG