CAMPSQ78
Title : Defensin
GenInfo Identifier : 118430
Source : Aeshna cyanea [Southern hawker dragonfly]
Taxonomy : Animalia, Insects
UniProt: P80154
PubMed : 1425705
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
M. luteus, A. viriduns, P. acidiluctici, R. meguterium, S. pyogenes, A. faecalis
Validated : Experimentally validated
Comment : Inactive against S.aureus, L. monncytogenes, S. typhimurium, P. aeruginosa, P. cepacia, E. coli D22
Pfam : PF01097 : Defensin_2 ( Arthropod defensin )
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 38
Sequence:
GFGCPLDQMQCHRHCQTITGRSGGYCSGPLKLTCTCYR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India