CAMPSQ757
Title : Mundticin KS
GenInfo Identifier : 19911783
Source : Enterococcus mundtii
Taxonomy : Bacteria
NCBI Taxonomy : 53346
UniProt: Q8RR63
PubMed : 12147478
Length : 98
Activity : Antibacterial
Target : Enterococcus faecium IFO13712 , Enterococcus faecalis IFO12964 , Enterococcus mundtii JCM 8731T , Lactobacillus plantarum ATCC 8041, Lactobacillus lactis NFRI 7307 , Lactobacillus curvatus JCM 1096 , Listeria monocytogenes ATCC 15313 , Listeria monocytoge
Validated : Experimentally Validated
Comment : Inactive against Bacillus subtilis ATCC 6633 , Bacillus subtilis 168 , Bacillus cereus IFO15305 , Enterococcus mundtii NFRI 7393 , Weissella viridescens JCM 1174 , Lactobacillus brevis JCM 1059 , Lactobacillus bavaricus JCM 1129 , Lactobacillus casei subs
Pfam : PF08951 : ( Enterocin A Immunity )
InterPro : IPR015046 : EntA_Immun.
AMP Family : Bacteriocin
Sequence:
MSNLKWFSGGDDRRKKAEVIITELLDDLEMDLGNESLRKVLGSYLKKLKNEGTSVPLVLS
RMNIEISNAIKKDGVSLNENQSKKLKELMSISNIRYGY