CAMPSQ746
Title : Perinerin
GenInfo Identifier : 51701746
Source : Perinereis aibuhitensis [Clamworm]
Taxonomy : Animalia, Annelida
UniProt: P84117
PubMed : 15113828
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
P.aeruginosa, B.megaterium, A.viridans, E.coli K-12, S.aureus, M.luteus, P.vulgaris, P.heliothis
Validated : Experimentally validated
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 51
Sequence:
FNKLKQGSSKRTCAKCFRKIMPSVHELDERRRGANRWAAGFRKCVSSICRY

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India