CAMPSQ618
Title : Gallinacin-1 alpha
GenInfo Identifier : 73915343, 546441
Source : Gallus gallus [Chicken]
Taxonomy : Animalia, Aves
UniProt: P46157
PubMed : 8150085
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
E.coli, S.aureus
Validated : Experimentally validated
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH34_9 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0030141 Cellular component Secretory granule TAS
GO:0031731 Molecular function CCR6 chemokine receptor binding IBA
GO:0042056 Molecular function Chemoattractant activity IBA
GO:0060326 Biological process Cell chemotaxis IBA
GO:0006952 Biological process Defense response TAS
GO:0042742 Biological process Defense response to bacterium IBA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 39
Sequence:
GRKSDCFRKNGFCAFLKCPYLTLISGKCSRFHLCCKRIW

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India