CAMPSQ556
Title : Lebocin-3 precursor
GenInfo Identifier : 6016491
Source : Bombyx mori [Silk moth]
Taxonomy : Animalia, Insects
UniProt: P55796
PubMed : 7654207
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Acinetobacter sp.NISL B-4653, E. coli HB1ll, Pseudomonas fluorescens IAM1179, Staphylococcus aureus ATCC6538P
Validated : Experimentally validated
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 32
Sequence:
DLRFLYPRGKLPVPTLPPFNPKPIYIDMGNRY

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India