CAMPSQ535
Title : Bacteriocin carnobacteriocin BM1
GenInfo Identifier : 584889
Source : Carnobacterium maltaromaticum
Taxonomy : Bacteria
NCBI Taxonomy : 2751
UniProt: P38579
PubMed : 8163526
Length : 43
Activity : Antibacterial
Gram Nature : Gram+ve
Target : C. divergens LV13 ( MIC = 93 microg/ml), C. piscicola UAL26 ( MIC = 128 microg/ml), Lactobacillus plantarum ATCC 4008 ( MIC = 8 microg/ml), Pediococcus parvulus ATCC 19371 ( MIC = 8 microg/ml), Listeria monocytogenes ATCC 15313 ( MIC = 64 microg/ml), List
Validated : Experimentally Validated
Pfam : PF01721 : ( Class II bacteriocin )
InterPro : IPR002633 : Bacteriocin_IIa.
IPR023384 : Bacteriocin_IIa_CS.
IPR023388 : Bacteriocin_IIa_dom.
IPR010133 : Bacteriocin_signal_seq.
AMP Family : Bacteriocin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0019835 Biological Process Cytolysis IEA
GO:0042742 Biological Process Defense response to bacterium IEA
Sequence:
AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH