CAMPSQ531
Title : Palustrin-3a
GenInfo Identifier : 55976286
Source : Rana palustris [Pickerel frog]
Taxonomy : Animalia, Amphibia
UniProt: P84281
PubMed : 11087945
Activity : Antibacterial
Gram Nature : Gram -ve
Target :
E.coli ( MIC = 1microM)
Validated : Experimentally validated
Comment : Inactive against S.aureus(<150 microM), C.albicans(<150 microM)
AMP Family : Palustrin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
Length : 48
Sequence:
GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLNNIGNTGCNEDEC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India