CAMPSQ465
Title : Dermaseptin-2
GenInfo Identifier : 461936, 740958
Source : Phyllomedusa sauvagii [Sauvage frog]
Taxonomy : Animalia, Amphibia
UniProt: P80278
PubMed : 8306981
Activity : Antibacterial, Antifungal
Target :
A.fumigatus
Validated : Experimentally validated
Pfam : PF12121 : DD_K ( Dermaseptin )
InterPro : IPR022731 : Dermaseptin.
AMP Family : Dermaseptin
Signature :
ID Type Pattern / HMM
DermaseptinH34_2 HMM
DermaseptinH_57 HMM
DermaseptinP34_2 Pattern A-L-W-x-T-M-L-K-K-L-G-T-M-A-L-H-A-G-K-A-A-L-G-A-A-A-[DN]-T-I-S-Q-G-T-Q
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 34
Sequence:
ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India