CAMPSQ3994
Title : Odorranain-P1b antimicrobial peptide
Source : Odorrana grahami [Yunnanfu frog]
Taxonomy : Animalia, Amphibia
UniProt: A6MBQ0
PubMed : 17272268
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
Escherichia Coli ( MIC = 6.25 microg/ml ), Staphylococcus aureus ( MIC = 3.12 microg/ml ), Bacillus subtilis ( MIC = 12.5 microg/ml ), Candida albicans ( MIC = 3.12 microg/ml )
Validated : Experimentally validated
Pfam : PF08018 : Antimicrobial_1 ( Frog antimicrobial peptide )
PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR012520 : Antimicrobial_frog_1.
IPR004275 : Brevinin.
AMP Family : Brevinin
Signature :
ID Type Pattern / HMM
BrevininH_224 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0098542 Biological process Defense response to other organism IEA
Length : 64
Sequence:
QEEERNADEEERRDERDVEVEKRVIPFVASVAAETMQHVYCAASKKMLKLNWKSSDVENH
LAKC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India