 |
| CAMPSQ3909 | |||||||||||||||||
| Title : | Microcin E492 | ||||||||||||||||
| Source : | Klebsiella pneumoniae | ||||||||||||||||
| Taxonomy : | Monera | ||||||||||||||||
| UniProt: | Q9Z4N4 | ||||||||||||||||
| PubMed : | 15102848 | ||||||||||||||||
| Activity : | Antibacterial | ||||||||||||||||
| Gram Nature : | Gram -ve | ||||||||||||||||
| Target : | Eschericia coli B ( MIC = 0.30 microM ), Eschericia coli F ( MIC = 0.30 microM ), Eschericia coli ML35p ( MIC = 0.30 microM ), Salmonella enteritidis ( MIC = 1.25 microM ) |
||||||||||||||||
| Validated : | Experimentally validated | ||||||||||||||||
| Comment : | Inactive against Enterobacter cloacae, Klebsiella pneumoniae, Vibrio alginolyticus, Vibrio harveyi, Vibrio penaeicida, Micrococcus luteus CIP5345, Staphylococcus aureus, Staphylococcus haemolyticus, Bacillus megaterium in the range of 0.02-10 micoM | ||||||||||||||||
| AMP Family : | Bacteriocin | ||||||||||||||||
| Gene Ontology : |
|
||||||||||||||||
| Length : | 84 | ||||||||||||||||
Sequence: |
GETDPNTQLLNDLGNNMAWGAALGAPGGLGSAALGAAGGALQTVGQGLIDHGPVNVPIPV LIGPSWNGSGSGYNSATSSSGSGS |
||||||||||||||||
| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH | |