CAMPSQ3739
Title : CXCL10
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: P02778
PDB: 1O80
Structure Database : CAMPST618
PubMed : 12949249
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Escherichia coli ATCC25922, Staphylococcus aureus ATCC29213
Validated : Experimentally validated
Pfam : PF00048 : IL8 ( Small cytokines (intecrine/chemokine), interleukin-8 like )
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0009897 Cellular component External side of plasma membrane IEA
GO:0005576 Cellular component Extracellular region IDA
GO:0005615 Cellular component Extracellular space IBA
GO:0008603 Molecular function CAMP-dependent protein kinase regulator activity TAS
GO:0042056 Molecular function Chemoattractant activity IDA
GO:0008009 Molecular function Chemokine activity IDA
GO:0045236 Molecular function CXCR chemokine receptor binding IBA
GO:0048248 Molecular function CXCR3 chemokine receptor binding IDA
GO:0008201 Molecular function Heparin binding IMP
GO:0005102 Molecular function Signaling receptor binding TAS
GO:0007189 Biological process Adenylate cyclase-activating G protein-coupled receptor signaling pathway IDA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0140374 Biological process Antiviral innate immune response IEP
GO:0008015 Biological process Blood circulation TAS
GO:0007166 Biological process Cell surface receptor signaling pathway TAS
GO:0007267 Biological process Cell-cell signaling TAS
GO:0034605 Biological process Cellular response to heat IEA
GO:0071222 Biological process Cellular response to lipopolysaccharide IMP
GO:0098586 Biological process Cellular response to virus IEP
GO:0070098 Biological process Chemokine-mediated signaling pathway IMP
GO:0006935 Biological process Chemotaxis IDA
GO:0042118 Biological process Endothelial cell activation IGI
GO:0007186 Biological process G protein-coupled receptor signaling pathway IMP
GO:0006954 Biological process Inflammatory response IBA
GO:0031640 Biological process Killing of cells of other organism IDA
GO:0007517 Biological process Muscle organ development TAS
GO:0016525 Biological process Negative regulation of angiogenesis IDA
GO:0045662 Biological process Negative regulation of myoblast differentiation IEA
GO:1901740 Biological process Negative regulation of myoblast fusion IEA
GO:0030593 Biological process Neutrophil chemotaxis IBA
GO:0008284 Biological process Positive regulation of cell population proliferation TAS
GO:0090026 Biological process Positive regulation of monocyte chemotaxis IDA
GO:0051281 Biological process Positive regulation of release of sequestered calcium ion into cytosol IDA
GO:2000406 Biological process Positive regulation of T cell migration IDA
GO:0045944 Biological process Positive regulation of transcription by RNA polymerase II TAS
GO:0042981 Biological process Regulation of apoptotic process IDA
GO:0042127 Biological process Regulation of cell population proliferation IDA
GO:1901509 Biological process Regulation of endothelial tube morphogenesis IDA
GO:0010819 Biological process Regulation of T cell chemotaxis IDA
GO:0010996 Biological process Response to auditory stimulus IEA
GO:0009409 Biological process Response to cold IEA
GO:0010332 Biological process Response to gamma radiation IEA
GO:0033280 Biological process Response to vitamin D IEA
GO:0007165 Biological process Signal transduction TAS
GO:0010818 Biological process T cell chemotaxis IMP
Length : 77
Sequence:
 VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA
IKNLLKAVSKERSKRSP

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India