CAMPSQ3479
Title : ISAMP
GenInfo Identifier : 22164302
Source : Ixodes scapularis [Black-legged tick]
Taxonomy : Animalia, Arachnida
UniProt: Q8MVA6
PubMed : 19852941
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Bacillus cereus ( MIC = 5.8+/- 0.05 microg/ml ), Bacillus subtilis ( MIC = 12.3+/- 0.1 microg/ml ), Staphylococcus aureus ( MIC = 10.4+/- 0.08 microg/ml ), Escherichia coli Edl 933 ( MIC = 3.2+/- 0.02 microg/ml ), Escherichia coli MG/655 ( MIC = 4.2+/- 0.03 microg/ml )
Validated : Experimentally validated
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0042742 Biological process Defense response to bacterium IDA
Length : 46
Sequence:
PDPGQPWQVKAGRPPCYSIPCRKHDECRVGSCSRCNNGLWGDRTCR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India