CAMPSQ3404
Title : Lactocyclicin Q
Source : Lactococcus sp. strain QU 12
Taxonomy : Bacteria
PubMed : 19139222
Length : 61
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Target : Lactococcus lactis subsp. lactis JCM 7638 ( MIC = 0.141 microM ), Lactococcus lactis subsp. lactis ATCC 19435 ( MIC = 0.141 microM ), Lactococcus lactis subsp. lactis IL1403 ( MIC = 0.141 microM ), Lactococcus lactis QU 1 ( MIC = 0.141 microM ), Lactococc
Validated : Experimentally Validated
AMP Family : Bacteriocin
Sequence:
LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIVKHQGKAAAAA
W