CAMPSQ333
Title : Beta-defensin 1 , peptide BNBD-1
GenInfo Identifier : 298766
Source : Bos taurus [Bovine]
Taxonomy : Animalia, Mammals
UniProt: P46159
PubMed : 8454635
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
E.coli ( MIC = 10-300 microg/ml )
Validated : Experimentally validated
Comment : Inactive against S.aureus 502A
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR006080 : Defensin_beta/neutrophil.
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH30_10 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0019898 Cellular component Extrinsic component of membrane ISS
GO:1990742 Cellular component Microvesicle ISS
GO:0097225 Cellular component Sperm midpiece ISS
GO:0031731 Molecular function CCR6 chemokine receptor binding ISS
GO:0042056 Molecular function Chemoattractant activity IBA
GO:0042802 Molecular function Identical protein binding ISS
GO:0035584 Biological process Calcium-mediated signaling using intracellular calcium source ISS
GO:0019933 Biological process CAMP-mediated signaling ISS
GO:0060326 Biological process Cell chemotaxis IBA
GO:0042742 Biological process Defense response to bacterium IBA
GO:0050829 Biological process Defense response to Gram-negative bacterium ISS
GO:0050830 Biological process Defense response to Gram-positive bacterium ISS
GO:0060474 Biological process Positive regulation of flagellated sperm motility involved in capacitation ISS
Length : 38
Sequence:
DFASCHTNGGICLPNRCPGHMIQIGICFRPRVKCCRSW

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India