CAMPSQ3132
Title : Brevinin-2PRa
Source : Rana pirica
Taxonomy : Animalia, Amphibians
PubMed : 15003829
Length : 37
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Target : Escherichia coli ATCC 25922 ( MIC = 6 microM ), Pseudomonas aeruginosa ATCC 27853 ( MIC = 3 microM ), Enterobacter cloacae NHTCC 53001 ( MIC = 6 microM ), Klebsiella pneumoniae KK3 9904 ( MIC = 6 microM ), Staphlococcus aureus NCTC 8325 ( MIC = 25 microM
Hemolytic Activity : Human erythrocytes ( HC50 = 55 microM )
Validated : Experimentally Validated
AMP Family : Brevinin
Sequence:
GLMSLFKGVLKTAGKHIFKNVGGSLLDQAKCKITGEC