| CAMPSQ307 |
| Title : |
Parabutoporin |
| GenInfo Identifier : |
26397622 |
| Source : |
Parabuthus schlechteri [Scorpion] |
| Taxonomy : |
Animalia, Arachnida |
| UniProt: |
P83312 |
| PubMed : |
12354111 |
| Activity : |
Antibacterial, Antifungal |
| Gram Nature : |
Gram +ve, Gram -ve |
| Target : |
E. coli ATCC 25922 ( MIC = 3.1 microM), E. coli DH5a ( MIC = 3.1 microM), P. aeruginosa ATCC 257853 ( MIC = 6.3 microM), K. pneumoniae ATCC 13833 ( MIC = 1.6 microM), S. choleraesuis ATCC 13311 ( MIC = 3.1 microM), H. influenzae ATCC 19418 ( MIC = 3.1 microM), B. subtilis ATCC 6051 ( MIC = 6.3 microM), L. monocytogenes NCTC 11994 ( MIC = 6.3 microM), M. luteus ATCC 9341 ( MIC = 25 microM), N. crassa ( MIC = 2.5 microM), B. cinerea ( MIC = 3.5 microM), F. culmorum ( MIC = 0.3 microM), S. cerevisiae ( MIC = 2 microM) |
| Validated : |
Experimentally validated |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular component |
Extracellular region |
IEA |
| GO:0016021 |
Cellular component |
Integral component of membrane |
IEA |
| GO:0090729 |
Molecular function |
Toxin activity |
IEA |
| GO:0042742 |
Biological process |
Defense response to bacterium |
IEA |
| GO:0050832 |
Biological process |
Defense response to fungus |
IEA |
| GO:0044179 |
Biological process |
Hemolysis in other organism |
IEA |
| GO:0006811 |
Biological process |
Ion transport |
IEA |
|
| Length : |
45 |
Sequence: |
FKLGSFLKKAWKSKLAKKLRAKGKEMLKDYAKGLLEGGSEEVPGQ |
