CAMPSQ298
Title : Enterocin P precursor
GenInfo Identifier : 2612870
Source : Enterococcus faecium
Taxonomy : Bacteria
NCBI Taxonomy : 1352
UniProt: O30434
PubMed : 9361419
Length : 44
Activity : Antibacterial
Gram Nature : Gram+ve
Target : L.curvatus ( MIC = 17 ng/ml ), L.fermentum ( MIC = 1 ng/ml ), L.sake ( MIC = 144 ng/ml ), Pediococcus acidalactici ( MIC = 69 ng/ml ), P.pntosaceus FBB61 ( MIC = 136 ng/ml ), P.pntosaceus FBB63 ( MIC = 18 ng/ml ), L.lactis BB24 ( MIC = 22 ng/ml ), Enteroc
Validated : Experimentally Validated
Comment : No inhibition detected against Lactobacillus acidophilus, L.bulgaricus, L.casei, L.helveticus, L.plantarum, L.reuteri, L.sake 148, L.salivarious, pedicoccus acidilactici 347, P.pentosaceus PCI, Leuconostoc cremoris, Lactococcus cremoris, L lac
Pfam : PF01721 : ( Class II bacteriocin )
InterPro : IPR002633 : Bacteriocin_IIa.
IPR023384 : Bacteriocin_IIa_CS.
IPR023388 : Bacteriocin_IIa_dom.
AMP Family : Bacteriocin
Signature :
ID Type Pattern / HMM T. Length
CAMPBacH35 HMM 35
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IDA
GO:0019835 Biological Process Cytolysis IEA
GO:0050830 Biological Process Defense response to Gram-positive bacterium IDA
Sequence:
ATRSYGNGVYCNNSKCWVNWGEAKENIAGIVISGWASGLAGMGH