| CAMPSQ295 |
| Title : |
Pandinin-1 |
| GenInfo Identifier : |
25453143 |
| Source : |
Pandinus imperator [Emperor scorpion] |
| Taxonomy : |
Animalia, Arachnida |
| UniProt: |
P83239 |
| PubMed : |
11563967 |
| Activity : |
Antibacterial |
| Gram Nature : |
Gram +ve, Gram -ve |
| Target : |
P.aeruginosa ( MIC = >20.8 microM ), E. coli ( MIC = 20.8 microM ), E. faecalis ( MIC = 1.3 microM ), C. albicans ( MIC = >20.8 microM ), B. subtilis ( MIC = 5.2 microM ), S. epidermidis ( MIC = 5.2 microM ), S. aureus ( MIC = 2.6 microM ) |
| Validated : |
Experimentally validated |
| Pfam : |
PF08102 : Antimicrobial_7 ( Scorpion antimicrobial peptide )
|
| InterPro : |
IPR012526 : Antimicrobial_7.
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular component |
Extracellular region |
IEA |
| GO:0016021 |
Cellular component |
Integral component of membrane |
IEA |
| GO:0042742 |
Biological process |
Defense response to bacterium |
IEA |
| GO:0006811 |
Biological process |
Ion transport |
IEA |
|
| Length : |
44 |
Sequence: |
GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATPT |
