CAMPSQ2912
Title : Coagulin
Source : Bacillus coagulans I-4
Taxonomy : Bacteria
PubMed : 9721655
Length : 44
Activity : Antibacterial
Gram Nature : Gram+ve
Target : Bacillus coagulans, Enterococcus faecium, Leuconostoc mesenteroides, Listeria innocua, Listeria monocytogenes, Listeria seeligheri, Oenococcus oeni, Pediococcus pentosaceus,
Validated : Experimentally Validated
AMP Family : Bacteriocin
Sequence:
KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGTHKC