CAMPSQ2776
Title : Charybdotoxin
Source : Leiurus quinquestriatus hebraeus [Yellow scorpion]
Taxonomy : Animalia, Arachnida
UniProt: P13487
PDB: 2CRD
Structure Database : CAMPST597
PubMed : 15118082
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
Staphylococcus aureus ATCC 27217, Bacillus subtilis ATCC 6633, Escherichia coli strain ML-35, Candida albicans ATCC 36082
Validated : Experimentally validated
Pfam : PF00451 : Toxin_2 ( Scorpion short toxin, BmKK2 )
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0008200 Molecular function Ion channel inhibitor activity IEA
GO:0015459 Molecular function Potassium channel regulator activity IEA
GO:0090729 Molecular function Toxin activity IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 37
Sequence:
EFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India