CAMPSQ246
Title : Oxyopinin-1
GenInfo Identifier : 22095934
Source : Oxyopes kitabensis
Taxonomy : Animalia, Arachnida
UniProt: P83247
PubMed : 11976325
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
E. coli ( MIC = 1. 6 microM ), B. subtilis, S. aureus ( MIC = 6. 2 microM )
Validated : Experimentally validated
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0016021 Cellular component Integral component of membrane IEA
GO:0090729 Molecular function Toxin activity IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0044179 Biological process Hemolysis in other organism IEA
GO:0006811 Biological process Ion transport IEA
Length : 48
Sequence:
FRGLAKLLKIGLKSFARVLKKVLPKAAKAGKALAKSMADENAIRQQNQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India