CAMPSQ2357
Title : Cathelicidin antimicrobial peptide precursor
GenInfo Identifier : 325652164
Source : Felis catus [Cat]
Taxonomy : Animalia, Mammals
UniProt: F1C962
Activity : Antimicrobial
Validated : Predicted
Comment : Unpublished, precursor
Pfam : PF12153 : CAP18_C ( LPS binding domain of CAP18 (C terminal) )
InterPro : IPR001894 : Cathelicidin.
IPR018216 : Cathelicidin_CS.
IPR022746 : Cathlecidin_C.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0042581 Cellular component Specific granule IEA
GO:0001530 Molecular function Lipopolysaccharide binding IBA
GO:0019731 Biological process Antibacterial humoral response IEA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IBA
GO:0050829 Biological process Defense response to Gram-negative bacterium IBA
GO:0050830 Biological process Defense response to Gram-positive bacterium IBA
GO:0045087 Biological process Innate immune response IBA
GO:0002227 Biological process Innate immune response in mucosa IEA
GO:0051873 Biological process Killing by host of symbiont cells IEA
GO:0042119 Biological process Neutrophil activation IEA
Length : 66
Sequence:
 LSYEEAVLRAVDGFNQRSSEKNLYRLLQLDSQPEGDEDPNTPKPVSFKVKETVCPKTTQR
PLEQCD

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India