CAMPSQ2276
Title : Ranatuerin-2C antimicrobial peptide
GenInfo Identifier : 239619023
Source : Rana catesbeiana [American bullfrog]
Taxonomy : Animalia, Amphibia
UniProt: C5IB06
Activity : Antimicrobial
Validated : Predicted
Pfam : PF08023 : Antimicrobial_2 ( Frog antimicrobial peptide )
PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR012521 : Antimicrobial_frog_2.
IPR004275 : Brevinin.
IPR018247 : EF_Hand_1_Ca_BS.
Signature :
ID Type Pattern / HMM
RanatuerinH_44 HMM
RanateurinH28_16 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium IEA
GO:0006955 Biological process Immune response IEA
Length : 44
Sequence:
 FTVKKSLLLLFFLGTITLSFCEQERGADEDNGGEMTEEEVKRGV

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India