CAMPSQ2176
Title : Amolopin-2h antimicrobial peptide
GenInfo Identifier : 167888508
Source : Amolops loloensis [Rufous-spotted torrent frog]
Taxonomy : Animalia, Amphibia
UniProt: C5H0D9
Activity : Antimicrobial
Validated : Predicted
Pfam : PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR004275 : Brevinin.
IPR004275 :
AMP Family : Temporin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0045087 Biological process Innate immune response IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 64
Sequence:
MFTLKKSLLLLFFLGTINLSLCEQERNAEEERRDDLGERQAEVEKRFFPIVGKLLFGLFG
LLGK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India