CAMPSQ2124
Title : L-amino-acid oxidase
GenInfo Identifier : 82088565
Source : Bitis gabonica [Gaboon adder]
Taxonomy : Animalia, Reptiles
UniProt: Q6T627
Activity : Antibacterial
Validated : Predicted
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0001716 Molecular function L-amino-acid oxidase activity IEA
GO:0090729 Molecular function Toxin activity IEA
GO:0006915 Biological process Apoptotic process IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0044179 Biological process Hemolysis in other organism IEA
Length : 60
Sequence:
GPMRIPEKHRIVREYIRKFGLQLNEFVQETENAWYYIKNIRKKVHEVKKDPGLLKYPVKP

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India