CAMPSQ2089
Title : Beta-defensin124
GenInfo Identifier : 84028885
Source : Pan troglodytes [Chimpanzee]
Taxonomy : Animalia, Mammals
UniProt: Q30KK4
Activity : Antibacterial
Validated : Predicted
Pfam : PF13841 : Defensin_beta_2 ( Beta defensin )
InterPro : IPR025933 : Beta_defensin.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0071224 Biological process Cellular response to peptidoglycan IBA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0007249 Biological process I-kappaB kinase/NF-kappaB signaling IBA
GO:0045087 Biological process Innate immune response IEA
GO:0071651 Biological process Positive regulation of chemokine (C-C motif) ligand 5 production IBA
GO:0090026 Biological process Positive regulation of monocyte chemotaxis IBA
Length : 49
Sequence:
EFKRCWKGQGACRTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India