CAMPSQ2071
Title : Beta-defensin14
GenInfo Identifier : 123780116
Source : Rattus norvegicus [Rat]
Taxonomy : Animalia, Mammals
UniProt: Q32ZH7
Activity : Antibacterial
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space ISO
GO:0031731 Molecular function CCR6 chemokine receptor binding IBA
GO:0042056 Molecular function Chemoattractant activity ISO
GO:0060326 Biological process Cell chemotaxis ISO
GO:0042742 Biological process Defense response to bacterium ISO
GO:0050829 Biological process Defense response to Gram-negative bacterium ISO
GO:0050830 Biological process Defense response to Gram-positive bacterium ISO
GO:0051873 Biological process Killing by host of symbiont cells ISO
GO:0031640 Biological process Killing of cells of other organism ISO
Length : 45
Sequence:
FIPKSLRRFFCRVRGGRCAILNCLGKEEQIGRCSNRGQKCCRKKK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India