CAMPSQ2045
Title : Beta-defensin132
GenInfo Identifier : 152125825
Source : Macaca fascicularis [Crab-eating macaque]
Taxonomy : Animalia, Mammals
UniProt: A4H265
Activity : Antibacterial
Validated : Predicted
Pfam : PF13841 : Defensin_beta_2 ( Beta defensin )
InterPro : IPR025933 : Beta_defensin.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IEA
GO:0061827 Cellular component Sperm head IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 73
Sequence:
GGSKCVSDTPGYCRTHCHRGETALFMCSPFRKCCISYSFLPQPDLPQLIGNHWPSRSRNT
QRKNKKQQTTVTP

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India