CAMPSQ2019
Title : Gallinacin-11
GenInfo Identifier : 82173548
Source : Gallus gallus [ Chicken]
Taxonomy : Animalia, Aves
UniProt: Q6IV20
Activity : Antibacterial
Validated : Predicted
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH_320 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0031731 Molecular function CCR6 chemokine receptor binding IBA
GO:0050829 Biological process Defense response to Gram-negative bacterium IBA
GO:0050830 Biological process Defense response to Gram-positive bacterium IBA
GO:0002227 Biological process Innate immune response in mucosa IBA
Length : 79
Sequence:
DTSRCVGYHGYCIRSKVCPKPFAAFGTCSWRQKTCCVDTTSDFHTCQDKGGHCVSPKIRC
LEEQLGLCPLKRWTCCKEI

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India