CAMPSQ2003
Title : Beta-defensin 20
GenInfo Identifier : 123780111
Source : Rattus norvegicus [Rat]
Taxonomy : Animalia, Mammals
UniProt: Q32ZH2
Activity : Antibacterial
Validated : Predicted
Pfam : PF13841 : Defensin_beta_2 ( Beta defensin )
InterPro : IPR025933 : Beta_defensin.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium ISO
GO:0050830 Biological process Defense response to Gram-positive bacterium ISO
GO:0045087 Biological process Innate immune response IEA
GO:0031640 Biological process Killing of cells of other organism ISO
Length : 75
Sequence:
KRCFSNVAGYCRKRCRLVEISEMGCLHGKYCCVNELENKRHKKDTVVEQPMEPRDKSKVQ
DYMVLPTITYYTITI

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India