CAMPSQ1874
Title : Beta-defensin103A
GenInfo Identifier : 122142466
Source : Equus caballus [Horse]
Taxonomy : Animalia, Mammals
UniProt: Q0W9P9
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR006080 : Defensin_beta/neutrophil.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0031731 Molecular function CCR6 chemokine receptor binding IBA
GO:0042056 Molecular function Chemoattractant activity IBA
GO:0060326 Biological process Cell chemotaxis IBA
GO:0042742 Biological process Defense response to bacterium IBA
Length : 45
Sequence:
GIINMLQKSYCKIRKGRCALLGCLPKEEQIGSCSVSGRKCCRKKK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India