CAMPSQ1855
Title : Cytoinsectotoxin-1g
GenInfo Identifier : 224471812
Source : Lachesana tarabaevi [Spider]
Taxonomy : Animalia, Arachnida
UniProt: P85259
PubMed : 18215128
Activity : Antibacterial
Gram Nature : Gram -ve
Target :
E. coli
Validated : Experimentally validated
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0090729 Molecular function Toxin activity IEA
GO:0051838 Biological process Cytolysis by host of symbiont cells IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium ISS
GO:0044179 Biological process Hemolysis in other organism IEA
Length : 69
Sequence:
GFFGNTWKKIKGKADKIMLKKAVKIMVKKEGISKEEAQAKVDAMSKKQIRLYVLKHYGKK
ALQKASEKL

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India