CAMPSQ1834
Title : Defensin-B1
GenInfo Identifier : 209572851
Source : Ornithorhynchus anatinus [Duckbill platypus]
Taxonomy : Animalia, Mammals
UniProt: P0C8A5
Activity : Antimicrobial
Validated : Predicted
Pfam : PF13841 : Defensin_beta_2 ( Beta defensin )
InterPro : IPR025933 : Beta_defensin.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0097225 Cellular component Sperm midpiece ISS
GO:0031731 Molecular function CCR6 chemokine receptor binding ISS
GO:0035584 Biological process Calcium-mediated signaling using intracellular calcium source ISS
GO:0019933 Biological process CAMP-mediated signaling ISS
GO:0050829 Biological process Defense response to Gram-negative bacterium ISS
GO:0050830 Biological process Defense response to Gram-positive bacterium ISS
GO:0045087 Biological process Innate immune response IEA
GO:0060474 Biological process Positive regulation of flagellated sperm motility involved in capacitation ISS
Length : 35
Sequence:
GMKEKCVTMGGYCRKQCRVQDALSGYCRNENPCCV

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India