CAMPSQ1709
Title : Antibacterial protein LL-37
GenInfo Identifier : 115503708
Source : Nomascus gabriellae [Red-cheeked gibbon]
Taxonomy : Animalia, Mammals
UniProt: Q1KLY2
Activity : Antibacterial
Validated : Predicted
Pfam : PF12153 : CAP18_C ( LPS binding domain of CAP18 (C terminal) )
InterPro : IPR001894 : Cathelicidin.
IPR001894 :
IPR018216 : Cathelicidin_CS.
IPR018216 :
IPR022746 : Cathlecidin_C.
IPR022746 :
AMP Family : Cathelicidin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0042119 Biological process Neutrophil activation ISS
Length : 37
Sequence:
LPGNFFRKAREKIGKEFKRIVQRIKDFLQHLVPRTEA

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India