CAMPSQ1697
Title : Vicin-like antimicrobial peptide 2a
GenInfo Identifier : 75207035
Source : Macadamia integrifolia [Macadamia nut]
Taxonomy : Plantae
UniProt: Q9SPL3
PubMed : 10571855
Activity : Antibacterial, Antifungal
Validated : Experimentally validated
Pfam : PF00190 : Cupin_1 ( Cupin )
PF04702 : Vicilin_N ( Vicilin N terminal region )
InterPro : IPR006045 : Cupin_1.
IPR014710 : RmlC-like_jellyroll.
IPR011051 : RmlC_Cupin.
IPR006792 : Vicilin_N.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0043245 Cellular component Extraorganismal space NAS
GO:0045735 Molecular function Nutrient reservoir activity NAS
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IDA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 35
Sequence:
 QCMQLETSGQMRRCVSQCDKRFEEDIDWSKYDNQE

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India