CAMPSQ166
Title : Proline-rich antimicrobial peptide 2
GenInfo Identifier : 156633554
Source : Galleria mellonella [Greater wax moth]
Taxonomy : Animalia, Insects
UniProt: P85212
PubMed : 17194500
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
M. luteus ( MIC = 8. 6 microM )
Validated : Experimentally validated
Comment : Inactive against B. circulans, L. monocytogenes, E. coli D31, E. coli ATCC 25922
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0045087 Biological process Innate immune response IDA
Length : 42
Sequence:
EIRLPEPFRFPSPTVPKPIDIDPILPHPWSPRQTYPIIARRS

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India