CAMPSQ165
Title : Proline-rich antimicrobial peptide 1
GenInfo Identifier : 156633553
Source : Galleria mellonella [Greater wax moth]
Taxonomy : Animalia, Insects
UniProt: P85214
PubMed : 11995991
Activity : Antibacterial, Antifungal
Gram Nature : Gram -ve
Target :
M. luteus ( MIC = 31.4-55.0 microM ), P. pastoris ( MIC = 8.3-16.5 microM ), Z. marxianus ( MIC = 8.3-16.5 microM ), S. pombe ( MIC = 5.5-11microM ), C. wickerhamii ( MIC = 8.3-16.5 microM )
Validated : Experimentally validated
Comment : Inactive against B.circulans, L.monocytogenes, E.coli D31, E.coli ATCC25922
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IDA
GO:0050832 Biological process Defense response to fungus IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0045087 Biological process Innate immune response IDA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 37
Sequence:
DIQIPGIKKPTHRDIIIPNWNPNVRTQPWQRFGGNKS

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India