CAMPSQ164
Title : Lebocin-like anionic peptide 1
GenInfo Identifier : 156630949
Source : Galleria mellonella [Greater wax moth]
Taxonomy : Animalia, Insects
UniProt: P85211
PubMed : 17194500
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve
Target :
M. luteus ( MIC = 22.7 microM ), L.monocytogenes ( MIC = 90.9 microM ), A.niger ( MIC = 90.9 microM ), T.harzianum ( MIC = 90.9 microM )
Validated : Experimentally validated
Comment : Inactive against B.circulans, S.aureus, and S.lutea, E.coli D31, E.coli ATCC 25922, S.typhimurium, S.cerevisae, P.pastoris, Z.marxianus, C.albicans, C.fructus, F.oxysporum
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IDA
GO:0050832 Biological process Defense response to fungus IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0045087 Biological process Innate immune response IDA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 42
Sequence:
EADEPLWLYKGDNIERAPTTADHPILPSIIDDVKLDPNRRYA

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India